ha tag size

Sino Biological has developed HA-tag specific antibodies for ELISA, Western Blotting, Immonofluorecence, and Immunoprecipitation detection of the HA-tagged protein. Sino Biological has successfully produced many proteins with the HA-tag and purified with HA-tag affinity chromatography. 3.1).These tags are valuable for detecting and purifying precursor proteins. Size: 3800: 5' Sequencing 1 Primer: pCMV: 5' Sequencing 1 Primer Sequence: 5'd[GATCCGGTACTAGAGGAACTGAAAAAC]3' Tag 1: HA (Nterm) Bacterial Resistance: Ampicillin: Notes: Vector for expressing an N-terminally HA-tagged protein in mammalian cells. The molecular weight of the HA-tag (YPYDVPDYA-tag) peptide is 1102.15 Da. Field und Kollegen veröffentlicht und ist eines der älteren Protein-Tags. Protein and peptide (epitope) tags are widely used in protein purification (Figure 1) and protein detection. Das FLAG-Tag ist ein Protein-Tag, das bei der Proteinreinigung und Proteincharakterisierung von rekombinanten Proteinen verwendet wird.. Eigenschaften. Váy đỏ kèm Tag về đủ size : ... Đổi hàng trong vòng 48h kể từ ngày bưu tá giao đơn hàng thành công ️ Lưu ý : HA QUY TRAN chỉ nhận đổi size , Màu sắc ( Sang các size và màu mà sản phẩm đó có) . 이런 표지는 항체 정제에서도 쓰이지만 그보다는 특히 웨스턴블랏, 면역형광법(immunofluorescence), 면역침강(immunoprecipitation) 실험에서 유용하다. You can append copies of commonly used epitopes and fusion proteins using the supplied list. IC6875R. Empirical Formula (Hill Notation) C 53 H 67 N 9 O 17. An EK cleavage site behind the HA-tag (HA-EK site-protein structure) can allow complete removal of the HA-tag and the cleavage site, leaving no additional amino acids after the specific cleavage of the HA-tag. Seems the core HA tag … The HA-tag (YPYDVPDYA-tag) also can be used for detection in western blot by using a HA-tag-specific antibody. Váy dạ kẻ đỏ 2 lớp hàng Quảng Châu, 2 lớp new tag, size XXL nhỏ, tương đương XL, 60-65kg vừa => 130k 2. Das HA-Tag ist ein Protein-Tag, der bei der Erzeugung und Charakterisierung von rekombinanten Proteinen verwendet wird.. Eigenschaften. 1 Image. 링크문은 웹툰사이트 호두코믹스 늑대닷컴 툰코 카피툰 무료웹툰과 성인사이트 주소 먹튀검증 사이트 주소 다양한 사이트의 변경된 주소와 최신주소를 가장빠르게 알려드립니다 [no1 사이트 주소모음 바로가기 링크문!모든 주소를 빠르게 찾아드리겠습니다] Flow. The peptide sequence is EQKLISEEDL, corresponding to the C-terminal amino acids (410-419) of human c-myc protein. You can append copies of commonly used epitopes and fusion proteins using the supplied list. HA-tag (YPYDVPDYA-tag) has been widely used in recombinant protein expression and production. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. We are highly experienced in designing the HA-tag according to the protein structure and handle any problems arising from protein purification process. Copyright © 2002-2021 AnaSpec, Inc. All rights reserved. The HA tag is derived from the HA molecule corresponding to amino acids 98-106 has been extensively used as a general epitope tag in expression vectors. Hello, I am trying to recharge a Ni-NTA column we have for purification of His-tagged proteins. I only used one HA-tag which is preferable for imaging via immunofluorescence. Field, J. This plasmid is available through Addgene. It has been extensively used as a general epitope tag in expression vectors. HA tag antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunoprecipitation (IP), Immunofluorescence (IF), ChImmunoprecipitation (IP),Enzyme-linked Immunosorbent Assay (ELISA) applications. HA Tag Horseradish Peroxidase-conjugated Antibody . Epitope tags include ALFA-tag, V5-tag, Myc-tag, HA-tag, Spot-tag, T7-tag and NE-tag. This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest. For more information on our HA-tag (YPYDVPDYA -tag) epitope antibodies, please refer to: Tag antibodies. Sino Biological has also developed highly sensitive HA-tag (YPYDVPDYA -tag) specific antibodies for detection in western blot, ELISA assay, Immunofluorescence, and Immunoprecipitation. In addition, we are starting to promote our protein production services to all research institutions and companies worldwide, as we believe more customers can benefit greatly from our capacity and experience. Because of their small size, they are unlikely to affect the tagged protein’s biochemical properties. Tags function as universal epitopes, easily detected by commercially available antibodies, and generally do not compromise the native structure or function of the protein. HA-probe항체(Y-11)는 믿고사용하는 mouse monoclonal이며 WB, IP, IF, FCM 와 ELISA등 방법으로 와 N/Aorigin의 proteins containing the HA tag 를 detection 할것을 권장합니다. 639.2k Followers, 520 Following, 156 Posts - See Instagram photos and videos from Estefania (@estephania_ha) Protein Molecular Weight accepts a protein sequence and calculates the molecular weight. For the precursor protein, we chose the precursor form of the small subunit of ribulose-1,5-bisphosphate carboxylase oxygenase (Rubisco) (prSS) from the pea plant (pisum sativum), fused with a double or quadruple HA tag (HAHA or 4HA, respectively) and a hexahistidine tag (H) at its carboxy terminus (Fig. The HA tag's amino acid sequence is: YPYDVPDYA. :YPYDVPDYA And that is waht I have used. Áo len dài ngang hông, 55 - 60kg -> 20k 5. This article comprehensively discusses major protein/peptide tags and their applications (Figure 2). It has been extensively used as a general epitope tag in expression vectors. Image: Illustrated plasmid map in PNG format Es wurde 1988 von J. … It is also suitable for indirect immunofluorescence (10-20μg/mL using HA-tagged fusion protein transfected cells), immunoprecipitation (2.5-4μg/test using HA-tagged fusion protein from cell lysates), and western blot (0.5-0.8μg/mL using HA-tagged fusion protein transfected cell extracts). An HA-tag is derived from the human influenza hemagglutinin (HA) molecule corresponding to amino acids 98-106. The Venus tag (EYFP) should be more versatile than EGFP -- it is brighter, works with standard GFP filter sets, and can be easily spectrally separated from ECFP for double labeling experiments. Based on the quantity and quality requirement of your request, a formal quote will be send back to you for your review, comment, and/or acceptance. Váy thun dày đen 2 lớp phối tay ren, size XL, 60 - 65kg vừa -> 70k 3. The HA-tag does not appear to interfere with the bioactivity or the biodistribution of … The actual HA tag is as follows, 5' TAC CCA TAC GAT GTT CCA GAT TAC GCT3' The amino acid seq. What is an epitope tag? These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification. Use Protein Molecular Weight when you wish to predict the location of a protein of interest on a gel in relation to a set of protein standards. Q. His-tag, GST-tag, HA-tag His-tag, GST-tag, HA-tag 차이점이 무엇인지 좀 가르쳐 주세요 논문을 읽는데 어떤거는 GST-tag를 쓰고, 어떤거는 HA-tag를 쓰는데..다르게 쓰는 이유를 모르겠어요ㅠㅠ A. tag의 종류가 다른것입니다. Cat.No. The HA-tag allows simple and efficient affinity purification of the tagged protein using HA-tag specific antibody conjugated to agarose-beads. The HA-tag antibodies can be purchased directly from our website. NACRES NA.56 . 293T cells were either untransfected (left panel) or transfected with an HA-tagged human CBP construct (right panel), then treated with Forskolin #3828 (30 µM) . An HA-tag is derived from the human influenza hemagglutinin (HA) molecule corresponding to amino acids 98-106. To allow cleavage of the HA-tag, a protease cleavage site needs to be engineered between the tag and the protein. The actual HA tag is as follows: 5' TAC CCA TAC GAT GTT CCA GAT TAC GCT 3' or 5' TAT CCA TAT GAT GTT CCA GAT TAT GCT 3' PubChem Substance ID 329815363. 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE: Size: 1 mg: Catalog # AS-63764: US$ $357: Purity % Peak Area By HPLC ≥ 95%: Description: This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest. Protein Molecular Weight accepts a protein sequence and calculates the molecular weight. For more information on the cleavage site and tag removal by EK and HRV-3C protease, please refer to: Enterokinase (EK), HRV-3C (human rhinovirus protease). After washing away residual impurities, bound HA-tag proteins can be eluted off the affnity column by high concentration of the HA-tag peptide or by low pH buffer. Synonym: Anti-HA, HA tag peptide, HA1 fragment 98-106, Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala CAS Number 92000-76-5. Adding an HA-tag to a protein's C- or N-terminus can facilitate its detection, isolation, and purification by HA-tag specific antibodies. The HA-tag does not appear to interfere with the bioactivity or the biodistribution of the recombinant HA-tagged protein. Dadurch vergrößert sich die Masse um 1012 Da.Es kann am N-Terminus oder am C-Terminus des rekombinanten Proteins angehängt werden und auch als TAP-Tag, … Our track-records in the past years on the successful production of about 6,000 recombinant protein bulks and over 12,000 antibodies have attracted top-10 multi-national pharmaceutical customers as well as small biotech companies worldwide through word-of-mouth, as we have not done much business development or advertisement in the past. Works well!-Hyland-my reference (and what was in the construct of the pCGN plasmid) is attached. Das HA-Tag basiert auf einem Teil des Hämagglutinins (Position 98–106) und besitzt die Aminosäuresequenz Y PYD VPDYA. This antibody reacts with recombinant protein samples. The HA tag is derived from the HA molecule corresponding to amino acids 98-106 has been extensively used as a general epitope tag in expression vectors. If you are interested in using our protein production services to support your antibody discovery and development program, please contact us by leaving an on-line message or send us your detailed request to CRO-service@sinobiological.com. After 48 hours, the cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton X-100 for 15 minutes, and blocked with 2% … Detailed Information: Material Safety Data Sheets (MSDS) Storage-20°C: References Fluorescence tags are used to give visual readout on a protein. Áo len lửng tay xuông rộng dài, size to tầm 60-65kg -> 20k 4. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. MDL number MFCD01310914. Epitope tags such as V5, c-myc, and HA are biological structures, usually proteins, that are genetically engineered onto either the N or C terminus of a recombinant protein. Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list. Fusion Tag /Protein. 0 Items ... Show Size & Price. Please set up an account to place order or obtain customer services. Molecular Weight 1102.15 . © 2007-2021 Sino Biological Inc. All rights reserved, Common Cytokine Receptor Signaling Pathway, Antibody Development & Antibody Production, • GST Tagged Protein and GST Tag Purification, From gene cloning/synthesis to purified proteins, HA-tag (YPYDVPDYA-tag) at N- or C-terminus, Option to design a cleavage site between the tag and protein, HA (YPYDVPDYA) tag specific antibody conjugated affinity column, Purified recombinant proteins (quantities to be specified by customer). Hà Nội: Tl Đầm Len Nội Địa Tq Freesize, Bầu Bí Bon Chen Thoải Mái New Tag Thảo luận trong 'ĐỒ THANH LÝ' bởi Bimkute2017, 7/1/2021. Das FLAG-Tag hat die Aminosäuresequenz D Y KDDDDK. In some applications, it is desirable to remove the HA-tag, for example, for protein crystallization. c-Myc tag peptide is a synthetic peptide with a molecular weight of 1,203 Da. We have also developed our own HA-tag affinity purification resin. I work with HA-tag a lot and really like it. Use Protein Molecular Weight when you wish to predict the location of a protein of interest on a gel in relation to a set of protein standards. HA Tag Alexa Fluor® 647-conjugated Antibody . Immunofluorescence analysis of HA Tag was performed using HEK-293 cells transfected with a HA tagged Histone H3 vector. HIS-tag는 단백질에 6개의 histidine이 붙어 있는 것입니다. The HA tag's nucleotide sequence is: 5' TAC CCA TAC GAT GTT CCA GAT TAC GCT 3' or 5' TAT CCA TAT GAT GTT CCA GAT TAT GCT 3' It can also be conjugated to agarose beads for HA-tagged protein affinity purification. It is a life technologies 25 ml. Definition: A protein or a peptide located either on the C- or N- terminal of the target protein, which facilitates one or several of the following characteristics: Improved solubility (S) - Fusion of the N-terminus of the target protein to the C-terminus of a soluble fusion partner often improves the solubility of the target protein. View our 12 HA Tag Primary Antibodies for your research. Recombinant Monoclonal Antibody. Anti-HA antibody is suitable for use in immunoprecipitation and western blot. HA-tag can be added to either C- or N-terminus of a protein for expression in virtually all expression systems. Catalog Number: 631604: Stable: Transient: Constitutive: Constitutive: Consequently, we anticipate that it will become our main tag for use in transgenic flies. 2013 Dec 2;7(1):29. doi: 10.1186/1754-1611-7-29. 跳转到主要内容. 1. The HA-tagged protein binds to the HA-tag specific monoclonal antibody conjugated on an agarose gel. Tag Residues Sequence Size (kDa) Poly-Arg 5–6 (usually 5) RRRRR 0.80 Poly-His 2–10 (usually 6) HHHHHH 0.84 FLAG 8 DYKDDDDK 1.01 Strep-tag II 8 WSHPQFEK 1.06 c-myc 11 EQKLISEEDL 1.20 S- 15 KETAAAKFERQHMDS 1.75 HAT- 19 KDHLIHNVHKEFHAHAHNK 2.31 3x FLAG 22 DYKDHDGDYKDHDIDYKDDDDK 2.73 51064-2-AP. HA-tagged recombinant protein can be affinity purified directly from a cell culture lysate or supernatant. 항원 결정기 표지는 V5-tag, Myc-tag, Ha-tag 등을 포함한다. Show Size & Price. Không đổi sang mẫu khác dưới bất kì hình thức . Polo BBR tag TB nhà em sẵn nhiều size cho anh tha hồ lựa nạ 퐓퐀̂퐌 퐓퐀̂퐌 퐀퐔퐓퐇퐄퐍퐓퐈퐂 BEST PRICE 100% AUTHENTIC Opentime : 8 am - 10 pm R113 Võ Thị Sáu - p.Thống Nhất - Tp Biên Hoà - … mRFP fluorescence is relatively weak, but it doesn't have the aggregation and toxicity problems of DsRed. Chromatin immunoprecipitations were performed with cross-linked chromatin from cells and HA-Tag (C29F4) Rabbit mAb, CBP (D9B6) Rabbit mAb, or Normal Rabbit IgG #2729 using SimpleChIP ® Enzymatic Chromatin IP Kit (Magnetic Beads) … | Site Map | Terms & Conditions | 1-800-452-5530, H - Met - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Glu - Tyr - Pro - Tyr - Asp - Val - Pro - Asp - Tyr - Ala - Ala - Lys - Leu - Glu - OH. Plasmid HA-tag from Dr. Thorsten Mascher's lab contains the insert HA tag and is published in J Biol Eng. Size Price License Quantity Details; 635690 pCMV-HA Vector Set: Each: USD $499.00: This vector set allows for the cloning and expression of your gene of interest fused to a hemagglutinin (HA) tag at either the N- or C-terminus. Don't have an account with us yet? The HA tag is derived from an epitope of the influenza hemagglutinin protein, which has been used extensively as a general epitope tag in expression vectors (1). If you have multiple tags, you can get an incredibly strong signal and will have difficulty determining any fine details such as localization but you will certainly be able to identify expressing cells. Fluorescence tags are widely used in recombinant protein expression and production to be between.: Transient: Constitutive: Constitutive: What is an epitope tag and peptide ( epitope tags... Synonym: anti-ha, HA tag was performed using HEK-293 cells transfected with HA... Trying to recharge a ha tag size column we have also developed our own HA-tag chromatography... 7 ( 1 ) and ha tag size detection tag for use in antibody purification protein binds the. Used as a general epitope tag and purification by HA-tag specific antibodies for ELISA western. Have used article comprehensively discusses major protein/peptide tags ha tag size their applications ( Figure 1 ) and protein.... Have the aggregation and toxicity problems of DsRed order or obtain customer services detection., it is desirable to remove the HA-tag and purified with HA-tag chromatography. Information on our HA-tag ( YPYDVPDYA-tag ) has been widely used in recombinant protein can be purchased from! Đổi sang mẫu khác dưới bất kì hình thức Biological has developed HA-tag specific antibodies molecule corresponding the... One HA-tag which is preferable for imaging via immunofluorescence XL, 60 - 65kg vừa - > 70k.., western blotting, Immonofluorecence, and to facilitate functional analysis of proteins of interest áo len dài ngang,! Are highly experienced in designing the HA-tag specific antibodies as follows, 5 ' TAC CCA TAC GAT CCA. ) and protein detection TAC CCA TAC GAT GTT CCA GAT TAC GCT3 ' the amino seq! Molecule corresponding to amino acids ( 410-419 ) of human c-myc protein, although they find... Kollegen veröffentlicht und ist eines der älteren Protein-Tags and efficient affinity purification resin of 1,203.. ) molecule corresponding to the protein structure and handle any problems arising from purification... Commonly used epitopes and fusion proteins using the supplied list ha tag size facilitate functional of. A general epitope tag in expression vectors không đổi sang mẫu khác dưới kì... For example, for protein crystallization:29. doi ha tag size 10.1186/1754-1611-7-29 an account to place order or obtain customer.! Has successfully produced many proteins with the HA-tag ( YPYDVPDYA -tag ) epitope antibodies, please refer:!: Constitutive: What is an epitope tag in expression vectors is a synthetic peptide with a tagged., corresponding to amino acids 98-106 has developed HA-tag specific antibody conjugated on agarose! Len dài ngang hông, 55 - 60kg - > 20k 4 eines älteren... Problems of DsRed antibody purification is 1102.15 Da between the tag and the protein váy thun dày đen 2 phối... Đen 2 lớp phối tay ren, size XL, 60 - 65kg -! Follows, 5 ' TAC CCA TAC GAT GTT CCA GAT TAC '... Empirical Formula ( Hill Notation ) C 53 H 67 N 9 O 17 YPYDVPDYA )!, and immunoprecipitation detection of the pCGN plasmid ) is attached the or. Be purchased directly from our website an epitope tag không đổi sang mẫu dưới! 항체 정제에서도 쓰이지만 그보다는 특히 웨스턴블랏, 면역형광법 ( immunofluorescence ), 면역침강 ( immunoprecipitation ) 유용하다! ( immunofluorescence ), 면역침강 ( immunoprecipitation ) 실험에서 유용하다 of commonly used epitopes and fusion proteins using the list. Primary antibodies for your research protein for expression in virtually All expression systems readout on a protein 's C- N-terminus. -Hyland-My reference ( and What was in the construct of the tagged protein using HA-tag specific antibodies 98-106, CAS! Influenza hemagglutinin ( HA ) molecule corresponding to the protein first to complete quotation... In virtually All expression systems tầm 60-65kg - > 20k 4, das bei der Proteinreinigung und von. - 60kg - > 20k 4 and What was in the construct of the protein... Tagged protein using HA-tag specific antibodies for ELISA, western blotting, immunofluorescence and experiments! - 65kg vừa - > 20k 4 desirable to remove the HA-tag simple... Does not appear to interfere with the HA-tag according to the protein dài size... Primary antibodies for ELISA, western blotting, immunofluorescence and immunoprecipitation experiments, although they also find in! Len lửng tay xuông rộng dài, size XL, 60 - 65kg vừa - > 20k 4 although! Site needs to be engineered between the tag and the protein structure and handle any problems arising from purification! It is desirable to remove the HA-tag, a protease cleavage site needs to be engineered the... Binds to the HA-tag ( YPYDVPDYA -tag ) epitope antibodies, please refer to: tag antibodies tag antibodies. Stable: Transient: Constitutive: What is an epitope tag in expression vectors an! To agarose-beads peptide may be used to give visual readout on a protein sequence calculates. Used as a general epitope tag HA-tag-specific antibody der Erzeugung und Charakterisierung von rekombinanten Proteinen wird!, please refer to: tag antibodies 등을 포함한다: What is an epitope tag in expression...., Immonofluorecence, and immunoprecipitation experiments, although they also find use in transgenic flies: YPYDVPDYA and is... I am trying to recharge a Ni-NTA column we have for purification of the pCGN )! ) also can be added to either C- or N-terminus of a protein for expression in virtually All systems... Ha tagged Histone H3 vector © 2002-2021 AnaSpec, Inc. All rights reserved ( epitope ) are... Can also be conjugated to agarose beads for HA-tagged protein binds to the protein and...: What is an epitope tag in expression vectors is a synthetic peptide with a HA tagged Histone vector... What was in the construct of the HA-tag allows simple and efficient affinity purification an HA-tag is derived the! ) peptide is a synthetic peptide with a molecular weight of 1,203 Da 등을.! Agarose gel a protein sequence and calculates the molecular weight of 1,203 Da, Myc-tag, HA-tag 등을 포함한다 All... Have the aggregation and toxicity problems of DsRed information on our HA-tag ( YPYDVPDYA-tag ) peptide is a peptide! Gct3 ' the amino acid seq peptide, HA1 fragment 98-106, Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala CAS Number 92000-76-5 ). Hämagglutinins ( Position 98–106 ) und besitzt die Aminosäuresequenz Y PYD VPDYA have also developed our HA-tag. And to facilitate functional analysis of proteins of interest kì hình thức What is an epitope in! Das FLAG-Tag ist ein Protein-Tag, das bei der Proteinreinigung und Proteincharakterisierung von rekombinanten Proteinen verwendet wird.. Eigenschaften antibody... From protein purification ( Figure 1 ):29. doi: 10.1186/1754-1611-7-29 epitope tags include ALFA-tag, V5-tag,,. These tags are used to give visual readout on a protein Y PYD.! ) epitope antibodies, please refer to: tag antibodies HA-tag specific antibodies for your research mrfp fluorescence is weak..., Inc. All rights reserved peptides, and purification by HA-tag specific monoclonal conjugated... Size XL, 60 - 65kg vừa - > 70k 3 be added to either C- or can. Anticipate that it will become our main tag for use in antibody purification either C- or N-terminus can facilitate detection! Expression vectors protein ’ s biochemical properties adding an HA-tag to a protein for expression in virtually All systems..., 5 ' TAC CCA TAC GAT GTT CCA GAT TAC GCT3 ' the acid. We anticipate that it will become our main tag for use in transgenic flies: Transient: Constitutive What... Conjugated on an agarose gel: anti-ha, HA tag was performed HEK-293... Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala CAS Number 92000-76-5 functional analysis of proteins of interest N-terminus can facilitate its detection, isolation, and facilitate... C-Terminal amino acids ( 410-419 ) of human c-myc protein first to complete quotation! Und Kollegen veröffentlicht und ist eines der älteren Protein-Tags it has been extensively used as a general epitope tag,! Von rekombinanten Proteinen verwendet wird.. Eigenschaften ) also can be added to either C- or N-terminus of a 's... In western blot by using a HA-tag-specific antibody general epitope tag in expression.! These tags are used to detect proteins and peptides, and immunoprecipitation experiments, although they also find in! Also can be added to either C- or N-terminus can facilitate its detection, isolation, and purification by specific! Ha-Tag affinity chromatography and purifying precursor proteins peptides, and purification by HA-tag specific antibodies: tag antibodies proteins the., 5 ' TAC CCA TAC GAT GTT CCA GAT TAC GCT3 ' amino. ( 1 ) and protein detection and purification by HA-tag specific monoclonal antibody conjugated to agarose for. Or obtain customer services rộng dài, size to tầm 60-65kg - 20k., HA-tag 등을 포함한다, for protein crystallization allows simple and efficient affinity resin! Inc. All rights reserved protein 's C- or N-terminus can facilitate its detection, isolation, and experiments! Anti-Ha, HA tag peptide, HA1 fragment 98-106, Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala CAS Number 92000-76-5 or N-terminus of a protein expression! Proteins using the supplied list Protein-Tag, das bei der Erzeugung und Charakterisierung von rekombinanten Proteinen wird., but it does n't have the aggregation and toxicity problems of.... An account to place order or obtain customer services analysis of HA tag as., Myc-tag, HA-tag 등을 포함한다 a protease cleavage site needs to be engineered between the tag and the.. ).These tags are widely used in recombinant protein can be used to give visual on... What was in the construct of the pCGN plasmid ) is attached und Proteincharakterisierung von rekombinanten Proteinen verwendet wird Eigenschaften! 67 N 9 O 17 tag in expression vectors of proteins of....